Protein coding transcript 228492

• Transcript: Ll_transcript_53277
• CDS coordinates: 112-1335 (+)
• Peptide sequence: MRISLSADHSLFVNCGGPEGEFEGNSYVGDLQTEGISNFVLRSDDQWAYSSTGIYLGNEDANHLAKNTFYLNISGPEYYQTARVAPLSLNYYGLCMMKGNYNVKLHFAEIMFSDDRTFSSLGRRIFDVSIQGIKYLKDYNIMEAAGGVGKGITEEFDVDVNDSTLEIHLYWAGKGTNAIPHRGVYGPLISAITVAPNFKIKSGGLSAGAIGGIVAASCVFVVLILFALRKMGFLGGKDTTDKELLDLKTGYFSLRQIKAATNNFDPANKIGEGGFGPVYKGVLPDGDVIAVKQLSSKSKQGNREFVNEIGMISALQHPNLVNLYGCCIEANQLLLIYEYMENNSLARALFGKEEQKLNLDWPTRMKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_53277

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53430 from Arabidopsis with 66.83% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53430 from Arabidopsis with 65.37% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449220.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;