Protein coding transcript 228517

• Transcript: Ll_transcript_54051
• CDS coordinates: 220-543 (+)
• Peptide sequence: MEEQFILRVPPSVAERIERLLNNNNINNSDAPSSSSEDNKSLDLSFSEDGRSGSFLIGNERFPASLLDLPCVVESFKTYDDSSLIKTADIAQMIMVRESGDPAPDVIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_54051

• Blastp: Transcription initiation factor TFIID subunit 7 from Arabidopsis with 67.59% of identity
• Blastx: Transcription initiation factor TFIID subunit 7 from Arabidopsis with 66.67% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5414)
• Kegg: Link to kegg annotations (AT1G55300)
• CantataDB: Link to cantataDB annotations (CNT0001798)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416674.1)
• Pfam: TAFII55 protein conserved region (PF04658.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;