Protein coding transcript 228530

• Transcript: Ll_transcript_54050
• CDS coordinates: 3-389 (-)
• Peptide sequence: LETKHNNYMKRQEELDNDMRKCKEEFKEFERQDVKHQEDYKHLTQKIKKLEDKVEKDSKKLEALVKEGEDSTDLIPKLEDDIPKLQKLLIEEERLLEEIIETSKVETEKYRSELSRVRAELEPWEKQLI
• ORF Type: internal

Annotations of Ll_transcript_54050

• Blastp: Structural maintenance of chromosomes protein 4 from Arabidopsis with 66.67% of identity
• Blastx: Structural maintenance of chromosomes protein 4 from Arabidopsis with 66.67% of identity
• Eggnog: Required for chromosome condensation and partitioning (By similarity)(COG1196)
• Kegg: Link to kegg annotations (AT5G48600)
• CantataDB: Link to cantataDB annotations (CNT0001234)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432441.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;