Transcript | Ll_transcript_54050 |
---|---|
CDS coordinates | 3-389 (-) |
Peptide sequence | LETKHNNYMKRQEELDNDMRKCKEEFKEFERQDVKHQEDYKHLTQKIKKLEDKVEKDSKKLEALVKEGEDSTDLIPKLEDDIPKLQKLLIEEERLLEEIIETSKVETEKYRSELSRVRAELEPWEKQLI |
ORF Type | internal |
Blastp | Structural maintenance of chromosomes protein 4 from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Structural maintenance of chromosomes protein 4 from Arabidopsis with 66.67% of identity |
Eggnog | Required for chromosome condensation and partitioning (By similarity)(COG1196) |
Kegg | Link to kegg annotations (AT5G48600) |
CantataDB | Link to cantataDB annotations (CNT0001234) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432441.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer