| Transcript | Ll_transcript_53761 |
|---|---|
| CDS coordinates | 1-345 (+) |
| Peptide sequence | EEVQQNPVPTEAGKKKKKKKIRLPTNDLQWKNPHDFAAENYMMPMGPPAGYNSYWNGMQPCMDGFMAPYAGPMQMMHYGLGPLDMPFASGFPPDPFGMQGYMMPPVPPHRDLAQF |
| ORF Type | internal |
| Blastp | E3 ubiquitin ligase PARAQUAT TOLERANCE 3 from Arabidopsis with 36.92% of identity |
|---|---|
| Blastx | E3 ubiquitin ligase PQT3-like from Arabidopsis with 43.07% of identity |
| Eggnog | Retinoblastoma binding protein 6(COG5222) |
| Kegg | Link to kegg annotations (AT4G17410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421620.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer