| Transcript | Ll_transcript_53757 |
|---|---|
| CDS coordinates | 1-357 (+) |
| Peptide sequence | EEVQQNPVPTEAGKKKKKKKIRLPTNDLQWKNPHDFAAENYMMPMGPPAGYNSYWNGMQPCMDGFMAPYAGPMQMMHYGLGPLDMPFASGFPPDPFGMQGYMMPPVPPHMYVIVFLGK* |
| ORF Type | 5prime_partial |
| Blastp | E3 ubiquitin ligase PARAQUAT TOLERANCE 3 from Arabidopsis with 35.77% of identity |
|---|---|
| Blastx | - |
| Eggnog | Retinoblastoma binding protein 6(COG5222) |
| Kegg | Link to kegg annotations (AT4G17410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421620.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer