Protein coding transcript 228586

• Transcript: Ll_transcript_55505
• CDS coordinates: 66-446 (+)
• Peptide sequence: MLTLHRDLGNSNLSGHLVPQLGNLQHLQYLELYKNNIQGVIPPELGNLKNLISLDLYNNNISGTVPPSLGNLKNLVFLRLNDNRLTGPIPKELVGLPNLKVVNVSSNDLCGTIPTTGPFEHIPLNK*
• ORF Type: complete

Annotations of Ll_transcript_55505

• Blastp: Leucine-rich repeat protein 1 from Arabidopsis with 82.2% of identity
• Blastx: Leucine-rich repeat protein 1 from Arabidopsis with 82.2% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G21090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460496.1)
• Pfam: Leucine Rich repeats (2 copies) (PF12799.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;