Protein coding transcript 228610

• Transcript: Ll_transcript_53345
• CDS coordinates: 1300-1602 (+)
• Peptide sequence: MHHVVLGDDPEVKQGKPSPDIFLAAANRFEGGRVDPSNILVFEDAPSGVLAAKNAGMSVVMVPDPRLDKSFHDAADQVLKSLLDFNPSEWGLPPFEDNGS*
• ORF Type: complete

Annotations of Ll_transcript_53345

• Blastp: (DL)-glycerol-3-phosphatase 2 from Arabidopsis with 76.53% of identity
• Blastx: (DL)-glycerol-3-phosphatase 2 from Arabidopsis with 72.66% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT5G57440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454369.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;