Transcript | Ll_transcript_53116 |
---|---|
CDS coordinates | 2-304 (+) |
Peptide sequence | FSQNQRAAFVQILMRFGVGDFDWKEFTSRMKQKTYEEIKDYGTLFLSHIAEDITDSSIFADGVPKDGLRIQDVLVRIAILLLIKDKVSSSFIFWILTVYD* |
ORF Type | 5prime_partial |
Blastp | CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 67.05% of identity |
---|---|
Blastx | CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 67.05% of identity |
Eggnog | helicase activity(ENOG410XNUT) |
Kegg | Link to kegg annotations (AT2G25170) |
CantataDB | Link to cantataDB annotations (CNT0001594) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416871.1) |
Pfam | Domain of Unknown Function (DUF1086) (PF06461.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer