Protein coding transcript 228649

• Transcript: Ll_transcript_53116
• CDS coordinates: 2-304 (+)
• Peptide sequence: FSQNQRAAFVQILMRFGVGDFDWKEFTSRMKQKTYEEIKDYGTLFLSHIAEDITDSSIFADGVPKDGLRIQDVLVRIAILLLIKDKVSSSFIFWILTVYD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_53116

• Blastp: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 67.05% of identity
• Blastx: CHD3-type chromatin-remodeling factor PICKLE from Arabidopsis with 67.05% of identity
• Eggnog: helicase activity(ENOG410XNUT)
• Kegg: Link to kegg annotations (AT2G25170)
• CantataDB: Link to cantataDB annotations (CNT0001594)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416871.1)
• Pfam: Domain of Unknown Function (DUF1086) (PF06461.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;