Protein coding transcript 228688

• Transcript: Ll_transcript_54020
• CDS coordinates: 709-1314 (+)
• Peptide sequence: MGAGGHGVPPLGSPDGRVRYKFASFWNRNHAFRNLQRAANNFHEILEVEKKENTESELHAHSSSAQGGKILDKVPEESIPKTGKLQPFIKAEALVGIYNDDFPCTAEQFLNLLLNDDSHFTNKYRLVRKDTKLVIGQWHTAEEYDGQVREITFRSLCNNPMCPPDTAVTEWQHFVLSPDNKKLVRLLILFTYDNTSKNIDK*
• ORF Type: complete

Annotations of Ll_transcript_54020

• Blastp: BAG-associated GRAM protein 1 from Arabidopsis with 69.73% of identity
• Blastx: BAG-associated GRAM protein 1 from Arabidopsis with 72.06% of identity
• Eggnog: GRAM domain-containing protein(ENOG410ZP01)
• Kegg: Link to kegg annotations (AT3G59660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423975.1)
• Pfam: Domain of unknown function (DUF4782) (PF16016.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;