Protein coding transcript 2287

• Transcript: Ll_transcript_324635
• CDS coordinates: 58-774 (+)
• Peptide sequence: MKHDETRRLSDEYEVSNILGRGGFSVVRKGTKKSSSEKIHVAIKTLRRVGTSNNPFGTPRTKVGGGDGGGEKSIAASIMGFTTLRQVSVSDALLTNEILVMRKIVENVSPHPNVIDLYDVYEDSNGVHLVLELCSGGELFDRIVAQDRYTETEAAAVVRQIAAGLEAIHKVNIIHRDLKPENCLFLDVRKDSPLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGKITTKSDMWS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_324635

• Blastp: Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 from Medicago with 82.35% of identity
• Blastx: Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 from Medicago with 82.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_8g043970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451357.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;