Transcript | Ll_transcript_324635 |
---|---|
CDS coordinates | 58-774 (+) |
Peptide sequence | MKHDETRRLSDEYEVSNILGRGGFSVVRKGTKKSSSEKIHVAIKTLRRVGTSNNPFGTPRTKVGGGDGGGEKSIAASIMGFTTLRQVSVSDALLTNEILVMRKIVENVSPHPNVIDLYDVYEDSNGVHLVLELCSGGELFDRIVAQDRYTETEAAAVVRQIAAGLEAIHKVNIIHRDLKPENCLFLDVRKDSPLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGKITTKSDMWS |
ORF Type | 3prime_partial |
Blastp | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 from Medicago with 82.35% of identity |
---|---|
Blastx | Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 from Medicago with 82.35% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_8g043970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451357.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer