Protein coding transcript 228771

• Transcript: Ll_transcript_55435
• CDS coordinates: 194-640 (+)
• Peptide sequence: MGLRFSSFFKPYPYHSPIVPSKPTFEDLPESCVVLIMAYMDPPQICNLATLNRTFRSASWADFVWESKLPSNYDVIVRKIFNDFPCDLGMREIYSRLCRVNNFDGGTKKVWLDRSLGKICMSVSAKGLSITGIDDRRYWNHIPTGESR*
• ORF Type: complete

Annotations of Ll_transcript_55435

• Blastp: F-box protein PP2-A12 from Arabidopsis with 59.06% of identity
• Blastx: F-box protein PP2-A12 from Arabidopsis with 71.85% of identity
• Eggnog: F-box protein(ENOG410Y934)
• Kegg: Link to kegg annotations (AT1G12710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446610.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;