Protein coding transcript 228779

• Transcript: Ll_transcript_54300
• CDS coordinates: 2015-2716 (+)
• Peptide sequence: MYRYRKKYKRVSIKALKSWARQILQGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAILRGSQPAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCVLEMFTSDYPYSECSNPAQIYKKVTLGKLPMAFYRIEDMEAQKFIGKCLGPASKRPSAKDLLLDPFLMSDESSSSDNFLTQKPLLNNIEMGKLHLSDNLTRTEMKIIGKLNPGDDTIFLKVQIPDKDGL*
• ORF Type: complete

Annotations of Ll_transcript_54300

• Blastp: Probable serine/threonine-protein kinase WNK4 from Arabidopsis with 68.49% of identity
• Blastx: Probable serine/threonine-protein kinase WNK4 from Arabidopsis with 68.31% of identity
• Eggnog: WNK lysine deficient protein kinase(ENOG410XQWZ)
• Kegg: Link to kegg annotations (AT5G58350)
• CantataDB: Link to cantataDB annotations (CNT0001612)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461641.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;