Protein coding transcript 228860

• Transcript: Ll_transcript_53724
• CDS coordinates: 269-979 (+)
• Peptide sequence: MKSALLSAIGSVVPHGGLPVLLLLLLTYFTSTSTAYDALDPTGNITLKWDVISWTPDGYVAVVTMFNFQQYRHIQDPGWSLGWTWAKKEVIWNMMGAQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPNNAVSSFQISVGSAGTTNKTVKLPKNFTLKAPGPGYTCGPAKIVRPTQYITSDKRRTTQALSKLVSEFIDLDIVRYKYAFFQNFL*
• ORF Type: complete

Annotations of Ll_transcript_53724

• Blastp: Protein COBRA from Arabidopsis with 76.21% of identity
• Blastx: Protein COBRA from Arabidopsis with 83.15% of identity
• Eggnog: cobra-like protein(ENOG410YAAC)
• Kegg: Link to kegg annotations (AT5G60920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437139.1)
• Pfam: COBRA-like protein (PF04833.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;