| Transcript | Ll_transcript_53744 |
|---|---|
| CDS coordinates | 339-821 (+) |
| Peptide sequence | MCPIRIHWHVKLNYKEYWRIKITITNFNYRMNYSQWNLVVQHPNFDNITENFSFNYKSLSPYEGLNDTAMLWGVKFYNDFLSSAGPLGNVQSEILFRKDKSTFTFDKGWAFPRRIYFNGENCVMPPPDAYPWLPNASSKLVLSLLTTVIATLASMFILLN* |
| ORF Type | complete |
| Blastp | Protein COBRA from Arabidopsis with 82.76% of identity |
|---|---|
| Blastx | Protein COBRA from Arabidopsis with 69.32% of identity |
| Eggnog | cobra-like protein(ENOG410YAAC) |
| Kegg | Link to kegg annotations (AT5G60920) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437139.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer