Protein coding transcript 229036

• Transcript: Ll_transcript_54505
• CDS coordinates: 885-2108 (+)
• Peptide sequence: MRQFIISSETDAIREMEEKGDQVETARFIKEEVKNQLKKCLEEAQSHLRSLSGPKLALIIDGKCLMYALDPSLRVMLLNLSLNCHAVVCCRVSPLQKAQVTSMVKKGAHKITLSIGDGANDVSMIQAAHVGVGISGMEGMQAVMASDFSIAQFRYLADLLLVHGRWSYLRICKVVIYFFYKNLTFTLTQFWFTFQTGFSGQRFYDDWFQSLYNVIFTALPVIIVGLFDKDVSASLSKKYPQLYMEGIKNVFFKWRVVAIWAFFSVYQSLVFFYFVSTTNLSAKNSAGKVFGLWDVSTMAFTCVVVTVNLRLLLICNSITRWHYVGVGGSILAWFLFIFIYSGISTPYDRQENIYFVIYVLMSTFYFYITLLLVPVAALFCDFVYQGYIFLIYRTPVLFMHDIDGNIS*
• ORF Type: complete

Annotations of Ll_transcript_54505

• Blastp: Phospholipid-transporting ATPase 3 from Arabidopsis with 79.27% of identity
• Blastx: Phospholipid-transporting ATPase 3 from Arabidopsis with 78.24% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G59820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431014.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;