Transcript | Ll_transcript_54090 |
---|---|
CDS coordinates | 709-1059 (+) |
Peptide sequence | MVSFRYSWTSREIDDAENASFLLAADVIYSDDLTDAFFSILERLMSTGSAKVLYMALEKRYNFSLSDLDVVANGYSHFRSYIKDEDEIKSLESRTMTNFVGKRMDFSQIPQYVREYE |
ORF Type | 3prime_partial |
Blastp | Methyltransferase-like protein 22 from Mus with 36.94% of identity |
---|---|
Blastx | Methyltransferase-like protein 22 from Mus with 36.94% of identity |
Eggnog | Methyltransferase like 22(ENOG410Z8JH) |
Kegg | Link to kegg annotations (239706) |
CantataDB | Link to cantataDB annotations (CNT0001078) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436431.1) |
Pfam | Lysine methyltransferase (PF10294.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer