Protein coding transcript 229051

• Transcript: Ll_transcript_54090
• CDS coordinates: 709-1059 (+)
• Peptide sequence: MVSFRYSWTSREIDDAENASFLLAADVIYSDDLTDAFFSILERLMSTGSAKVLYMALEKRYNFSLSDLDVVANGYSHFRSYIKDEDEIKSLESRTMTNFVGKRMDFSQIPQYVREYE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_54090

• Blastp: Methyltransferase-like protein 22 from Mus with 36.94% of identity
• Blastx: Methyltransferase-like protein 22 from Mus with 36.94% of identity
• Eggnog: Methyltransferase like 22(ENOG410Z8JH)
• Kegg: Link to kegg annotations (239706)
• CantataDB: Link to cantataDB annotations (CNT0001078)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436431.1)
• Pfam: Lysine methyltransferase (PF10294.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;