Protein coding transcript 229110

• Transcript: Ll_transcript_52974
• CDS coordinates: 95-742 (+)
• Peptide sequence: MADSSPITVLVTGAAGRTGKLVYNKLKENPNQYVARGLVRTEESKQKIGGADDVFVGDIRDAESIVPAIQGIDTLIILTSAVPLIKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKSAGVKHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLLDKDGGLRELLVGKDDELLQTNTKSIPRADVAEVCIQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_52974

• Blastp: Uncharacterized protein At2g37660, chloroplastic from Arabidopsis with 80.47% of identity
• Blastx: Uncharacterized protein At2g37660, chloroplastic from Arabidopsis with 71.31% of identity
• Eggnog: epimerase dehydratase(COG0702)
• Kegg: Link to kegg annotations (AT2G37660)
• CantataDB: Link to cantataDB annotations (CNT0001448)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448537.1)
• Pfam: NmrA-like family (PF05368.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;