Transcript | Ll_transcript_53001 |
---|---|
CDS coordinates | 337-939 (+) |
Peptide sequence | MGELTQTELYPSNSPRTQQVWKSVLSWFGFFFQIFFQIIRALSHYPLLSFSSSNSNSSFKPLPSIQLHHHLDSPPETAVSDHYPSQKLLVVLDLDETLVCAYETSSLPAALRTQAIEAGLNWFELECVSSDKEGEGKPKINYVTVFERPGLKEFIRQLSEFADLVLFTAGLEGYARPLVDRIDIENRFSLRLYRPSTTST* |
ORF Type | complete |
Blastp | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 from Mus with 32.26% of identity |
---|---|
Blastx | Mitochondrial import inner membrane translocase subunit tim50 from Schizosaccharomyces with 33.07% of identity |
Eggnog | CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190) |
Kegg | Link to kegg annotations (227292) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433625.1) |
Pfam | NLI interacting factor-like phosphatase (PF03031.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer