Protein coding transcript 229121

• Transcript: Ll_transcript_52984
• CDS coordinates: 214-822 (+)
• Peptide sequence: MGELTQTEVYSSSPSNSPRTQQLWKSMLSWLTFFFKIIRALVHYPLLSFSSSNTSFKPLPSIELHGHHDSAAASLEITDADSGHHPSHKLMVVLDLDETLICAYETSSLPATLRTQAIEAGLNWFEFECMPSDKEGEGKSKINHVTVFERPGLKEFIRQLSEFAELVLFTAGLEGYARPLVDIIDMENRFSLRLYRPSTTTT*
• ORF Type: complete

Annotations of Ll_transcript_52984

• Blastp: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 from Mus with 28.5% of identity
• Blastx: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 from Mus with 28.23% of identity
• Eggnog: CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190)
• Kegg: Link to kegg annotations (52468)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461300.1)
• Pfam: NLI interacting factor-like phosphatase (PF03031.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;