Protein coding transcript 229124

• Transcript: Ll_transcript_52988
• CDS coordinates: 1273-1575 (+)
• Peptide sequence: MLDSCREYREHVKDLTYISKDLCRIVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSEQKDVRPMLYEKFHMPDWFQKQGIPASCWT*
• ORF Type: complete

Annotations of Ll_transcript_52988

• Blastp: Mitochondrial import inner membrane translocase subunit TIM50 from Phytophthora with 39.73% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit tim50 from Schizosaccharomyces with 38.89% of identity
• Eggnog: CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461300.1)
• Pfam: NLI interacting factor-like phosphatase (PF03031.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;