Transcript | Ll_transcript_52990 |
---|---|
CDS coordinates | 214-822 (+) |
Peptide sequence | MGELTQTEVYSSSPSNSPRTQQLWKSMLSWLTFFFKIIRALVHYPLLSFSSSNTSFKPLPSIELHGHHDSAAASLEITDADSGHHPSHKLMVVLDLDETLICAYETSSLPATLRTQAIEAGLNWFEFECMPSDKEGEGKSKINHVTVFERPGLKEFIRQLSEFAELVLFTAGLEGYARPLVDIIDMENRFSLRLYRPSTTTT* |
ORF Type | complete |
Blastp | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 from Mus with 28.5% of identity |
---|---|
Blastx | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 from Mus with 28.23% of identity |
Eggnog | CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190) |
Kegg | Link to kegg annotations (52468) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461300.1) |
Pfam | NLI interacting factor-like phosphatase (PF03031.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer