Protein coding transcript 229188

• Transcript: Ll_transcript_52499
• CDS coordinates: 3-521 (+)
• Peptide sequence: KMAASTMTLSSTSLAGQAVKLSPSTPDLGVGRISMRKTVTKKVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVLLMGAIEG
• ORF Type: internal

Annotations of Ll_transcript_52499

• Blastp: Chlorophyll a-b binding protein 21, chloroplastic from Nicotiana with 87.86% of identity
• Blastx: Chlorophyll a-b binding protein 3, chloroplastic from Soja with 91.77% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107775016)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463510.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;