Protein coding transcript 229194

• Transcript: Ll_transcript_52496
• CDS coordinates: 2-331 (+)
• Peptide sequence: SMRKTVTKKVSSGSPWYGPDRVEYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGL
• ORF Type: internal

Annotations of Ll_transcript_52496

• Blastp: Chlorophyll a-b binding protein 3, chloroplastic from Soja with 96.36% of identity
• Blastx: Chlorophyll a-b binding protein 3, chloroplastic from Soja with 96.36% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410ZHBU)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463510.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;