| Transcript | Ll_transcript_52497 |
|---|---|
| CDS coordinates | 3-386 (+) |
| Peptide sequence | VKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSAAPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIGGGPLG |
| ORF Type | internal |
| Blastp | Chlorophyll a-b binding protein, chloroplastic from Apium with 96.88% of identity |
|---|---|
| Blastx | Chlorophyll a-b binding protein, chloroplastic from Apium with 96.88% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017440188.1) |
| Pfam | Chlorophyll A-B binding protein (PF00504.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer