Protein coding transcript 229207

• Transcript: Ll_transcript_53372
• CDS coordinates: 402-710 (+)
• Peptide sequence: MIGTTRPTHYHVLHDEIGFSADDLQELVHSLSYVYQRSTTAVSVVAPICYAHLAAAQMAQFMKFDEFSETCSSYGGMTSIGAPQVPQLPSLHQDVTNSMFFC*
• ORF Type: complete

Annotations of Ll_transcript_53372

• Blastp: Protein argonaute 4A from Oryza sativa with 81.37% of identity
• Blastx: Protein argonaute 4A from Oryza sativa with 77.72% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (4324438)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418271.1)
• Pfam: Piwi domain (PF02171.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;