Protein coding transcript 229238

• Transcript: Ll_transcript_53793
• CDS coordinates: 665-1099 (+)
• Peptide sequence: MEAYKRWVRQNKEYVHSLESLANGLTWLLPERFSESDIAPEAVTTILGIITALNEHIIDTAPTGNNTGSTEQYSFPYPLCLSALKDLETLVEVVAQHYYGDDKKWNFLAITEGTKVDIRCCFMEGRHIMMRHIRIISVHIIKQA*
• ORF Type: complete

Annotations of Ll_transcript_53793

• Blastp: Peroxisome biogenesis protein 16 from Arabidopsis with 57.6% of identity
• Blastx: Peroxisome biogenesis protein 16 from Arabidopsis with 54.92% of identity
• Eggnog: Peroxisomal membrane protein(ENOG4111GEA)
• Kegg: Link to kegg annotations (AT2G45690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431061.1)
• Pfam: Peroxisomal membrane protein (Pex16) (PF08610.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;