Protein coding transcript 229252

• Transcript: Ll_transcript_54615
• CDS coordinates: 126-449 (+)
• Peptide sequence: MLEAGMIRPSVSPFSSPLILVKKKDGGWRFCVDYRALNKITIPNKFPIPVIEELLDELGGASIFSKLDLKSGYYQIRMKERDIEKTTFRTHEGHYEFVVMPFGLTNAP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_54615

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 57.41% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 46.85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: Link to cantataDB annotations (CNT0002695)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459981.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;