Transcript | Ll_transcript_54615 |
---|---|
CDS coordinates | 126-449 (+) |
Peptide sequence | MLEAGMIRPSVSPFSSPLILVKKKDGGWRFCVDYRALNKITIPNKFPIPVIEELLDELGGASIFSKLDLKSGYYQIRMKERDIEKTTFRTHEGHYEFVVMPFGLTNAP |
ORF Type | 3prime_partial |
Blastp | Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 57.41% of identity |
---|---|
Blastx | Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 46.85% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YGR109W-B) |
CantataDB | Link to cantataDB annotations (CNT0002695) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459981.1) |
Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer