Protein coding transcript 229272

• Transcript: Ll_transcript_54079
• CDS coordinates: 739-1212 (+)
• Peptide sequence: MLSGKPLFRGKNVVHQLDLMTDLLGTPPAESIARIRNEKAKRYLSSMRKKQPVPLSQKFPKADPLALSLLERLLAFDPKDRPSAEEALADPYFNGLSNIDCEPSTQPISKLEFEFERRRLTKDDVRELIYREILEYHPQMLQEYLNGGDLTSFMYPR*
• ORF Type: complete

Annotations of Ll_transcript_54079

• Blastp: Mitogen-activated protein kinase 15 from Arabidopsis with 81.41% of identity
• Blastx: Mitogen-activated protein kinase 8 from Oryza sativa with 77.04% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT1G73670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006598124.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;