Protein coding transcript 229275

• Transcript: Ll_transcript_54064
• CDS coordinates: 74-499 (+)
• Peptide sequence: MVVTHSHISSLSHDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMTDLLGTPPAESISRIRNEKARRYLSSMRKKQPVPFSKKFPNADPSALNLLQRLIAFDPKDRPTAEEALADPYF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_54064

• Blastp: Mitogen-activated protein kinase 15 from Arabidopsis with 88.37% of identity
• Blastx: Mitogen-activated protein kinase 15 from Arabidopsis with 88.37% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT1G73670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436722.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;