Protein coding transcript 229276

• Transcript: Ll_transcript_54065
• CDS coordinates: 177-752 (+)
• Peptide sequence: MLTGKPLFPGKNVVHQLDLMTDLLGTPPAESIARIRNEKARRYLSSMRKKQPIPLTEKFPNADPLALSTLERLLAFDPKDRPTAEEALADPYFNGLSNIDREPSTHPISKLEFEFERRRLTKDDVRELIYREILEYHPQMLQEYLNGGDLTSFMYPSGVDLFKRQFAHLEEHYGKGQRSSPLQRQHASLPR*
• ORF Type: complete

Annotations of Ll_transcript_54065

• Blastp: Mitogen-activated protein kinase 9 from Arabidopsis with 83.25% of identity
• Blastx: Mitogen-activated protein kinase 9 from Arabidopsis with 84.42% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT3G18040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424386.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;