Transcript | Ll_transcript_54071 |
---|---|
CDS coordinates | 74-583 (+) |
Peptide sequence | MVVTHSHISSLSHDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMTDLLGTPPEESISRIRNEKARRYLSSMRKKQPVPLSKKFPNADPLALNLLQRLIAFDPKDRPTAEEALADPYFYGLSNVDREPSTQPISKLEFEFEKRKLT |
ORF Type | 3prime_partial |
Blastp | Mitogen-activated protein kinase 15 from Arabidopsis with 85.35% of identity |
---|---|
Blastx | Mitogen-activated protein kinase 15 from Arabidopsis with 85.35% of identity |
Eggnog | Mitogen-activated protein kinase(ENOG410XNY0) |
Kegg | Link to kegg annotations (AT1G73670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430477.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer