Protein coding transcript 229282

• Transcript: Ll_transcript_54072
• CDS coordinates: 1-873 (+)
• Peptide sequence: TANVFHRDLKPRNILANADCKLKICDFGLARVSFNEAPSAIFWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMTDLLGTPPDESISRIRNEKARRYLSSMRRKQPVPLSKNFPNADPLALNLLQRLIAFDPKDRPTAEEALADPYFQGLSNVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPEMLEEYLRGGDLTTSFMYPSGVDRFKRQFAHLEEPNAKGERNTPLQRQHVSLPRERVATPKDNSQSNGSNLQN
• ORF Type: internal

Annotations of Ll_transcript_54072

• Blastp: Mitogen-activated protein kinase 9 from Arabidopsis with 82.82% of identity
• Blastx: Mitogen-activated protein kinase 9 from Arabidopsis with 82.82% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT3G18040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457268.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;