Protein coding transcript 229325

• Transcript: Ll_transcript_53853
• CDS coordinates: 805-1257 (+)
• Peptide sequence: MEEREIFGSEHVVKGNEATDSFHVAPRTENVVQFPGTAVELPDVALVSTVVTPGTAGKKKRGRPRKYGPDGKVAAAAMALSPMPISASIPWTGQFSAWKRGRGKSVESMKKSNFYEVENAGPGYGIACSVGANFTPYVLTVNAGEVFSAV*
• ORF Type: complete

Annotations of Ll_transcript_53853

• Blastp: AT-hook motif nuclear-localized protein 3 from Arabidopsis with 54.74% of identity
• Blastx: AT-hook motif nuclear-localized protein 1 from Arabidopsis with 80% of identity
• Eggnog: Domain of unknown function (DUF296)(ENOG41114DS)
• Kegg: Link to kegg annotations (AT4G25320)
• CantataDB: Link to cantataDB annotations (CNT0000128)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449431.1)
• Pfam: AT hook motif (PF02178.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;