Protein coding transcript 229332

• Transcript: Ll_transcript_53871
• CDS coordinates: 2-979 (+)
• Peptide sequence: ELPAVAAELPAVAAELPAVAAELPAVAAELPAVAAKVPAVAAVSAVVTPVTEGKKKRGRPRKYGPDGKVAAVARALSPMPISASIPLTGQLSAWKRGIGKPVEYAGQGDGIAYSVGANFSTYVLTVNAGEDVTMKIMSFSQQGHRAICILSANGLISNVTLRQPTSSGGTLTYEGQFEIVSLSGSFMPTENGLTKSRSGGMSVSLVGPDGRLMGGGLAGLLVAAGPVQVVVASFLPSQELEHKSKKPRMEHISTTTTTHVTTISAEEIKNSFGGVKPIMMTPSFQVDNYGSYNNGQSSRNLSAAAEAPLQDKDSNPTQLGAGVAC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_53871

• Blastp: AT-hook motif nuclear-localized protein 6 from Arabidopsis with 48.85% of identity
• Blastx: AT-hook motif nuclear-localized protein 3 from Arabidopsis with 60.96% of identity
• Eggnog: AT hook motif domain containing protein, expressed(ENOG410YFD3)
• Kegg: Link to kegg annotations (AT5G62260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451022.1)
• Pfam: AT hook motif (PF02178.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;