Protein coding transcript 229334

• Transcript: Ll_transcript_53854
• CDS coordinates: 3-371 (+)
• Peptide sequence: SVESMKKSNFYEVENAGPGYGIACSVGANFTPYVLTVNAGEDVTMKIMSFAQQGSSAICILSANGSISNVTLRQPTSSGGTLTYEVSSIFGHRHKKKMSLVLQLHVAYKQPSLSDILCTTWC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_53854

• Blastp: AT-hook motif nuclear-localized protein 3 from Arabidopsis with 66.28% of identity
• Blastx: AT-hook motif nuclear-localized protein 1 from Arabidopsis with 69.33% of identity
• Eggnog: Domain of unknown function (DUF296)(ENOG41114DS)
• Kegg: Link to kegg annotations (AT4G25320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441135.1)
• Pfam: Domain of unknown function (DUF296) (PF03479.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;