Transcript | Ll_transcript_53862 |
---|---|
CDS coordinates | 714-1202 (+) |
Peptide sequence | MNGCLLVFTLFLLDTRLQGRFEILSLSGSFMPTENGIARSRSGGMSVSLAGPDGRVMGGGLAGLLIAAGPVQVVVGSFLLGHHLEHKNKKQRVEHISTITTTHVNPISNDGRIKFSFGGFKPIMTPAAFQEQNIASYNNVQDSRNSSADDKEAFPEDSNPSQ* |
ORF Type | complete |
Blastp | AT-hook motif nuclear-localized protein 1 from Arabidopsis with 62.89% of identity |
---|---|
Blastx | AT-hook motif nuclear-localized protein 3 from Arabidopsis with 80.6% of identity |
Eggnog | AT hook motif domain containing protein, expressed(ENOG410YFD3) |
Kegg | Link to kegg annotations (AT4G12080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441135.1) |
Pfam | Domain of unknown function (DUF296) (PF03479.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer