Protein coding transcript 229351

• Transcript: Ll_transcript_54576
• CDS coordinates: 205-672 (+)
• Peptide sequence: MSTLRVAHPIPPVSDDCEQLRKAFEGWGTNEGLIISILAHRDAAQRKHIRETYHETYGEDLLKVLDKELTSDFERLVRLWTLDPSERDAILANEATKKWTSSNQVLVEIACTRSSDHLFFVRKAYHALYKKSLEEDVAHHTTGDYRKVLNTDLQS*
• ORF Type: complete

Annotations of Ll_transcript_54576

• Blastp: Annexin D1 from Arabidopsis with 74.5% of identity
• Blastx: Annexin D1 from Arabidopsis with 73.53% of identity
• Eggnog: annexin A7(ENOG410XPUN)
• Kegg: Link to kegg annotations (AT1G35720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430876.1)
• Pfam: Annexin (PF00191.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;