Transcript | Ll_transcript_52884 |
---|---|
CDS coordinates | 74-757 (+) |
Peptide sequence | MISQFFILSQRGDNIVFRDYRGEVQKGSAEIFFRKVKFWEDGGLEEAPPVFNVDGVNYFHVKVVGLLFVATTRVNVSPSFVLELLQRIARVTKDYLGVLNEDSLRKNFVLVYELLDEVIDFGYVQTTSTELLKSYVFNEPLVVDAARLPALGPASIFAQGTKRMPGIAVTKSVVATELGGRKREEIFVDIIEKISITFSSSVSTYILFDFEYHNFGCILFDLSCSRV* |
ORF Type | complete |
Blastp | AP-4 complex subunit mu from Arabidopsis with 82.61% of identity |
---|---|
Blastx | AP-4 complex subunit mu from Arabidopsis with 82.61% of identity |
Eggnog | Adaptor-related protein complex(ENOG410XPFS) |
Kegg | Link to kegg annotations (AT4G24550) |
CantataDB | Link to cantataDB annotations (CNT0002502) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431272.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer