Protein coding transcript 229518

• Transcript: Ll_transcript_55228
• CDS coordinates: 474-869 (+)
• Peptide sequence: MSFYIGREASKLWKRICSEVTTEINLLAENWKYLLAGLVFQYVHGLAARGVHYLHRPGPILQDVGFVLLPELGKEKAYISETLFTIIFLSFVLWTFHPFILKSRKIYTVLIWCRVLAFLVVSVDHTMSCLL*
• ORF Type: complete

Annotations of Ll_transcript_55228

• Blastp: Phosphatidylinositol:ceramide inositolphosphotransferase 2 from Arabidopsis with 78.51% of identity
• Blastx: Phosphatidylinositol:ceramide inositolphosphotransferase 2 from Arabidopsis with 78.51% of identity
• Eggnog: sphingomyelin synthase(ENOG410XNSC)
• Kegg: Link to kegg annotations (AT2G37940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430755.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;