Protein coding transcript 22952

• Transcript: Ll_transcript_365182
• CDS coordinates: 371-1024 (+)
• Peptide sequence: MTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQENLVAWARPLLTSDVGLETIIDPSLGADVPIDSVAKVAAIASMCVQPEVSNRPFMGEVVQALKLVCSECDEAKEEACLRSCSQEDLFIDMDVGISPSGQLEDNLERRFSGTNFDNGIDIERGLSASELFNSSARFGRQESESFRRHSYSGPLRTGRSRRLWQIMRRLSGGTVSEHGNMFKL*
• ORF Type: complete

Annotations of Ll_transcript_365182

• Blastp: Receptor-like serine/threonine-protein kinase ALE2 from Arabidopsis with 49.13% of identity
• Blastx: Receptor-like serine/threonine-protein kinase ALE2 from Arabidopsis with 50.63% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G20300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442881.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;