Protein coding transcript 229525

• Transcript: Ll_transcript_55229
• CDS coordinates: 219-818 (+)
• Peptide sequence: MSFYIGREASKLWKRFCAEITTEINLLAENWKYLLAGLVCQYIHGLAARGVHYLHKPGPTLQDLGFFLLPELGQDKAYLSETLFTTIFVSFFVWTFHPFILKDKKIYTVLIWCRVLSFLVACQALRIVSFYSTQLPGPNYHCREGSELARLPPPKSALEVLLINFPHGVLYGCGDLIFSSHMIFTLVFVLTYQKYGTRR*
• ORF Type: complete

Annotations of Ll_transcript_55229

• Blastp: Phosphatidylinositol:ceramide inositolphosphotransferase 1 from Arabidopsis with 81.91% of identity
• Blastx: Phosphatidylinositol:ceramide inositolphosphotransferase 1 from Arabidopsis with 80.69% of identity
• Eggnog: sphingomyelin synthase(ENOG410XNSC)
• Kegg: Link to kegg annotations (AT3G54020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459453.1)
• Pfam: PAP2 superfamily C-terminal (PF14360.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;