Protein coding transcript 229528

• Transcript: Ll_transcript_55209
• CDS coordinates: 413-805 (+)
• Peptide sequence: MFYIGREASKLWKRFCSEVTTEINLLAENWKYLLAGLFCQYLHGLAAHGVHYLHKPGPTLQDLGFFLLPELGQDKAYLSETLFTIIFVSFFLWTFHPFILKNKKIYTVLIWCRVLSFLVVSVLYLCLLKN*
• ORF Type: complete

Annotations of Ll_transcript_55209

• Blastp: Phosphatidylinositol:ceramide inositolphosphotransferase 2 from Arabidopsis with 82.2% of identity
• Blastx: Phosphatidylinositol:ceramide inositolphosphotransferase 2 from Arabidopsis with 82.88% of identity
• Eggnog: sphingomyelin synthase(ENOG410XNSC)
• Kegg: Link to kegg annotations (AT2G37940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465100.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;