Protein coding transcript 229533

• Transcript: Ll_transcript_53887
• CDS coordinates: 2-604 (+)
• Peptide sequence: PDYLEHGIVQKLLLVGCSGSGTSTIFKQAKILYKSVPFSEEEQENIKLTIQSNVYAYIGILLEGRERFEDQISGALKTRHSSEHDITGTSSKPDEKTIYSIGPRLKAFSDWLLKTMVSGKIDAIFPAATREYAPLIEELWNDTAIKATYERRSELEMLPSVGSYFLERVRPVFDFYQHFNFHVCSCQLRARLLVRKRDTI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_53887

• Blastp: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 65.12% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 64.2% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT2G23460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447166.1)
• Pfam: G-protein alpha subunit (PF00503.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;