Protein coding transcript 229594

• Transcript: Ll_transcript_54317
• CDS coordinates: 1-297 (+)
• Peptide sequence: ETPLQVKLNGVATIIGKIGLFFAVVTFTVLVKGLMSRKIREGRFWWWSGDDAIEMLEFFAIAVTIVVVAVPEGLPLAVTLSLAFAMKKMMNDKALVRHL
• ORF Type: internal

Annotations of Ll_transcript_54317

• Blastp: Putative calcium-transporting ATPase 7, plasma membrane-type from Arabidopsis with 84.85% of identity
• Blastx: Putative calcium-transporting ATPase 7, plasma membrane-type from Arabidopsis with 84.85% of identity
• Eggnog: ATPase, Ca transporting, plasma membrane(ENOG410XNNC)
• Kegg: Link to kegg annotations (AT2G22950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432775.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;