Protein coding transcript 22960

• Transcript: Ll_transcript_366275
• CDS coordinates: 78-494 (+)
• Peptide sequence: MSTVMQPYLHESRHLHALKRARGSGGRFLNTKKLQESKATFADDGLDVSGCNNTQLNLSGNMSESKLPQMENYIDGASTTTCAGVTSATSSDDIFQQKGSDFRLLCGYPSHIGRNMQGYSAGMGGGGGRNQHHLSVLM*
• ORF Type: complete

Annotations of Ll_transcript_366275

• Blastp: Nuclear transcription factor Y subunit A-8 from Arabidopsis with 46.21% of identity
• Blastx: Nuclear transcription factor Y subunit A-8 from Arabidopsis with 44.29% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT1G17590)
• CantataDB: -
• Mirbase: cme-MIR169k (MI0023183)
• Ncbi protein: Link to NCBI protein (XP_019425144.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;