Protein coding transcript 22963

• Transcript: Ll_transcript_366278
• CDS coordinates: 251-1090 (+)
• Peptide sequence: MSILPQQCHKTKPLTFQFQDQDSSSSQLTGQSYPEVGSAQSGQFSIQYSNSSVCSTLSKTWAKSVDGFANSSVGCQDFAFPPSQMGQNQLLIHHGQLMGMAPVRIPLPLDLSEEPIYVNAKQYHAILRRRQYRAKLEAQNKLIKDRKPYLHESRHLHALKRARGSGGRFLNTKKLQESKATFADDGLDVSGCNNTQLNLSGNMSESKLPQMENYIDGASTTTCAGVTSATSSDDIFQQKGSDFRLLCGYPSHIGRNMQGYSAGMGGGGGRNQHHLSVLM*
• ORF Type: complete

Annotations of Ll_transcript_366278

• Blastp: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 44.52% of identity
• Blastx: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 51.35% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT1G72830)
• CantataDB: -
• Mirbase: cme-MIR169k (MI0023183)
• Ncbi protein: Link to NCBI protein (XP_019425144.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;