Protein coding transcript 229662

• Transcript: Ll_transcript_52702
• CDS coordinates: 218-682 (-)
• Peptide sequence: KQFGFVNFENPDSAAKALEALNGMNFDGRSLYVRRSLKKSERELELKKAFEQIMKEAAEKLQYVNLYINNLHECITGEDLRELFSVFGRVVSYQVCEYGSSFCSCIQNAQTFIFLKCLSFLSGLQVIHDPEYFSSGYGFVEFSTPEEANQAVSN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_52702

• Blastp: Polyadenylate-binding protein 8 from Arabidopsis with 44.44% of identity
• Blastx: Polyadenylate-binding protein 8 from Arabidopsis with 45.1% of identity
• Eggnog: poly(A) binding protein, cytoplasmic(ENOG410XR5X)
• Kegg: Link to kegg annotations (AT1G49760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414651.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;