Protein coding transcript 229756

• Transcript: Ll_transcript_55046
• CDS coordinates: 2-325 (+)
• Peptide sequence: GGLIQLNHGRPQPLQYVVNAAFLAALYSDYLDAADTPGWYCGPNFFSTDVLRNFSKTQINYILGNNPQKMSYVVGFGNKYPKHVHHRGASIPNNKVKYSCKGGWKWRD
• ORF Type: internal

Annotations of Ll_transcript_55046

• Blastp: Endoglucanase 25 from Arabidopsis with 84.26% of identity
• Blastx: Endoglucanase 25 from Arabidopsis with 84.26% of identity
• Eggnog: endoglucanase(ENOG410XP0H)
• Kegg: Link to kegg annotations (AT5G49720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426334.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;