Protein coding transcript 22981

• Transcript: Ll_transcript_366293
• CDS coordinates: 360-1022 (+)
• Peptide sequence: MGNCWCKLEPSDYRVSANNAKSEQNQAMKERNDDNKLPSNPEEVEDLRGNSAVNPLVAFTFDELKIMTGNFRPDSVLGGGGFGSVYKGFISEELREGLPSLAVAVKVHDGDNSHQGHREWLAEVIFLGQLSHPNLVKLIGYCCEDEHRVLIYEYMARGSVENNLFSKILLPMPWSIRMKIAFGAAKGLAFLHEAEKPVIYRDFKTSNILLDQVSTFKDLC*
• ORF Type: complete

Annotations of Ll_transcript_366293

• Blastp: Probable serine/threonine-protein kinase PBL16 from Arabidopsis with 75.8% of identity
• Blastx: Probable serine/threonine-protein kinase PBL16 from Arabidopsis with 75.8% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G56460)
• CantataDB: Link to cantataDB annotations (CNT0001383)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464034.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;