Protein coding transcript 229863

• Transcript: Ll_transcript_53230
• CDS coordinates: 539-1483 (+)
• Peptide sequence: MIAGTDDDLPPTHQNRIPRGGRLAGNGRSAVGSLPYPPRLYGEIDMETQIHQLEQEAYSSVLRAFKAQADAITWEKESLITELRKELRLSNEEHRELLGRVNADDVIKRIREWRQAVGHQPGMLSTGQALHDSNPSPTVSASRKKQKITPSVPSRSFGGPSPFPPQTVTTPHQPSSSTGKRGSVPGSKGKKQKPGQIAPSVSSMKQYPSSGPGGRNQVTNRAEGVSFDSLIGRRVRTKWPDDNNFYEAVITDYNPADDRHNLVYDMGSTEETWEWVNLSEIQYFNFRYLLKIFNGSVRILESINVGLLGALVMG*
• ORF Type: complete

Annotations of Ll_transcript_53230

• Blastp: Protein EMSY-LIKE 3 from Arabidopsis with 56.21% of identity
• Blastx: Protein EMSY-LIKE 3 from Arabidopsis with 56.21% of identity
• Eggnog: Chromosome 11 open reading frame 30(ENOG410YF3T)
• Kegg: Link to kegg annotations (AT5G13020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449564.1)
• Pfam: ENT domain (PF03735.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;